PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.D25HB
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 390aa    MW: 44043.4 Da    PI: 6.7179
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.D25HBgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.61.7e-51111341128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lppGfrFhP+deelv++yL kk ++++  l   + +vd++k+ePwd+p+++  + kewyf+++rd+kyatg r+nrat+sgyWkatgkd+++l+ kg+
  Araip.D25HB  11 LPPGFRFHPKDEELVCDYLMKKFTHNESLL---MIDVDLNKCEPWDIPETACVGGKEWYFYTQRDRKYATGLRTNRATASGYWKATGKDRPILR-KGS 104
                  79**********************999544...789************7777799**************************************9.999 PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                  lvg++ktLvfy+grapkg+kt+Wvmhe+r+
  Araip.D25HB 105 LVGMRKTLVFYQGRAPKGRKTEWVMHEFRI 134
                  ****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.07E-602158IPR003441NAC domain
PROSITE profilePS5100555.94811157IPR003441NAC domain
PfamPF023651.3E-2612134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MSNISLVEAR LPPGFRFHPK DEELVCDYLM KKFTHNESLL MIDVDLNKCE PWDIPETACV  60
GGKEWYFYTQ RDRKYATGLR TNRATASGYW KATGKDRPIL RKGSLVGMRK TLVFYQGRAP  120
KGRKTEWVMH EFRIEPPLPP PNTSSKEDWV LCRVFYKNRE VGGKPNSMGS CYDDTGSSSL  180
PALMDSFISF DQQQQPQTHL HADEYEQVPC FSIFSHTQTS PIFNHIMEPK LFPTNNNNNN  240
ATLYGGGGTT TTSNLGSCLD PFSCDRKEDW VLCRVFYKNR EVGGKPNSMG SCYDDTGSSS  300
LPALMDSFIS FDQQQQPQTH LHADEYEQVP CFSIFSHTQT SPIFNHIMEP KLFPTNNNNN  360
NATLYGGGGT TTTSNLGSCL DPFSCDRKAL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B3e-49615812166NAC domain-containing protein 19
4dul_A3e-49615812166NAC domain-containing protein 19
1ut7_B3e-49615812166NO APICAL MERISTEM PROTEIN
1ut7_A3e-49615812166NO APICAL MERISTEM PROTEIN
1ut4_B3e-49615812166NO APICAL MERISTEM PROTEIN
1ut4_A3e-49615812166NO APICAL MERISTEM PROTEIN
3swp_D4e-49615815169NAC domain-containing protein 19
3swp_C4e-49615815169NAC domain-containing protein 19
3swp_B4e-49615815169NAC domain-containing protein 19
3swp_A4e-49615815169NAC domain-containing protein 19
3swm_D4e-49615815169NAC domain-containing protein 19
3swm_C4e-49615815169NAC domain-containing protein 19
3swm_B4e-49615815169NAC domain-containing protein 19
3swm_A4e-49615815169NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016171234.10.0PREDICTED: NAC domain-containing protein 21/22-like
SwissprotQ84TE61e-111NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLA0A151SW561e-154A0A151SW56_CAJCA; NAC domain-containing protein 21/22
STRINGGLYMA15G40510.11e-151(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100103241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56010.21e-110NAC domain containing protein 1